PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015872669.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family MYB
Protein Properties Length: 488aa    MW: 53445.7 Da    PI: 7.7731
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015872669.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
   XP_015872669.1 14 KGLWSPEEDEKLLRHIAKYGHGCWSSVPKQAGLERCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding44.53.6e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++ eE+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
   XP_015872669.1  67 RGTFSREEENLIIELHAVLGNR-WSQIAAQLP-GRTDNDIKNLWNS 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-27664IPR009057Homeodomain-like
PROSITE profilePS5129419.347961IPR017930Myb domain
SuperFamilySSF466892.47E-2912108IPR009057Homeodomain-like
SMARTSM007171.7E-141363IPR001005SANT/Myb domain
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001672.42E-121761No hitNo description
PROSITE profilePS5129425.99262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2565116IPR009057Homeodomain-like
SMARTSM007174.2E-1366114IPR001005SANT/Myb domain
PfamPF002494.0E-1367111IPR001005SANT/Myb domain
CDDcd001672.86E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIA KYGHGCWSSV PKQAGLERCG KSCRLRWINY  60
LRPDLKRGTF SREEENLIIE LHAVLGNRWS QIAAQLPGRT DNDIKNLWNS CLKKKLRQRG  120
VDPVTHRPIS EDKDREAKSS GEKLVSVAIS NELNLLETEN SKKAAAAAAL FGAAQVVEAN  180
NSSLCSNKTT NTTTDNNNMM MMKELFLQEQ DTSSTSNCQQ PPSDYLGQLN SLHQFKYKYG  240
STTNTGSSTT ATTRLPSSNP CSNWFLQPGK STLDMNSHDD ALSNCNSIPI ILPLSLPIPI  300
PAPSSTSFPS STASCIANCK PTSLTFPPTA TGSIDNNNSM ASFPISNNSS SSSSNCFLEN  360
NNMFGWGLVA DCSTVSEKEA HIQVNNLMDS QAGAADDIKW AEYLSNPPTF LQTTTTTQHQ  420
NSHSLLCITS SSSSTSDIKS SETQHSVMWP PPHNSKHQQL QPSQLQTTSS DICAKDIHRL  480
TAALGGPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00427DAPTransfer from AT4G01680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015872669.10.0PREDICTED: transcription factor MYB86-like
RefseqXP_015872487.10.0PREDICTED: transcription factor MYB86-like
RefseqXP_015868916.10.0PREDICTED: transcription factor MYB86-like
TrEMBLB9I9971e-120B9I997_POPTR; Uncharacterized protein
STRINGPOPTR_0014s10680.11e-119(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.33e-86myb domain protein 55